Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 98585..99228 Replicon plasmid 2
Accession NZ_LR890199
Organism Escherichia coli isolate MINF_1D-sc-2280456

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag JMV89_RS24855 Protein ID WP_001034046.1
Coordinates 98812..99228 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag JMV89_RS24850 Protein ID WP_001261278.1
Coordinates 98585..98815 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMV89_RS24820 94096..94401 - 306 WP_001159868.1 type II toxin-antitoxin system toxin CcdB -
JMV89_RS24825 94403..94621 - 219 WP_000813634.1 type II toxin-antitoxin system antitoxin CcdA -
JMV89_RS24830 95188..95700 + 513 WP_000151784.1 hypothetical protein -
JMV89_RS24835 95734..96867 - 1134 WP_001542067.1 DUF3800 domain-containing protein -
JMV89_RS24840 97034..97807 - 774 WP_000905949.1 hypothetical protein -
JMV89_RS24845 97820..98320 - 501 WP_000528931.1 hypothetical protein -
JMV89_RS24850 98585..98815 + 231 WP_001261278.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JMV89_RS24855 98812..99228 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
JMV89_RS24860 99273..103067 - 3795 WP_001144732.1 hypothetical protein -
JMV89_RS24865 103448..103678 + 231 WP_001261286.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
JMV89_RS24870 103675..104091 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(B) / blaCTX-M-15 / sitABCD iucA / iucB / iucC / iucD / iutA 1..125802 125802


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T290270 WP_001034046.1 NZ_LR890199:98812-99228 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT290270 WP_001261278.1 NZ_LR890199:98585-98815 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References