Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 94096..94621 | Replicon | plasmid 2 |
| Accession | NZ_LR890199 | ||
| Organism | Escherichia coli isolate MINF_1D-sc-2280456 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | JMV89_RS24820 | Protein ID | WP_001159868.1 |
| Coordinates | 94096..94401 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | JMV89_RS24825 | Protein ID | WP_000813634.1 |
| Coordinates | 94403..94621 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMV89_RS24805 | 90006..91172 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| JMV89_RS24810 | 91760..92515 | - | 756 | WP_024946706.1 | replication initiation protein RepE | - |
| JMV89_RS24815 | 93289..94095 | - | 807 | WP_000016982.1 | site-specific integrase | - |
| JMV89_RS24820 | 94096..94401 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| JMV89_RS24825 | 94403..94621 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| JMV89_RS24830 | 95188..95700 | + | 513 | WP_000151784.1 | hypothetical protein | - |
| JMV89_RS24835 | 95734..96867 | - | 1134 | WP_001542067.1 | DUF3800 domain-containing protein | - |
| JMV89_RS24840 | 97034..97807 | - | 774 | WP_000905949.1 | hypothetical protein | - |
| JMV89_RS24845 | 97820..98320 | - | 501 | WP_000528931.1 | hypothetical protein | - |
| JMV89_RS24850 | 98585..98815 | + | 231 | WP_001261278.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| JMV89_RS24855 | 98812..99228 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(B) / blaCTX-M-15 / sitABCD | iucA / iucB / iucC / iucD / iutA | 1..125802 | 125802 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T290269 WP_001159868.1 NZ_LR890199:c94401-94096 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|