Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 5213..5772 Replicon plasmid 2
Accession NZ_LR890199
Organism Escherichia coli isolate MINF_1D-sc-2280456

Toxin (Protein)


Gene name relE Uniprot ID V0SVC8
Locus tag JMV89_RS24275 Protein ID WP_000421272.1
Coordinates 5213..5488 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0SRR3
Locus tag JMV89_RS24280 Protein ID WP_001387467.1
Coordinates 5488..5772 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMV89_RS24245 1263..2003 - 741 WP_001066953.1 tyrosine-type recombinase/integrase -
JMV89_RS24250 2124..2306 - 183 WP_042344623.1 hypothetical protein -
JMV89_RS24255 2649..2956 - 308 Protein_3 type II toxin-antitoxin system ParD family antitoxin -
JMV89_RS24260 3449..4618 + 1170 WP_001072355.1 hypothetical protein -
JMV89_RS24265 4651..4779 + 129 Protein_5 IS481 family transposase -
JMV89_RS24270 4814..5107 - 294 WP_001105060.1 hypothetical protein -
JMV89_RS24275 5213..5488 - 276 WP_000421272.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
JMV89_RS24280 5488..5772 - 285 WP_001387467.1 ribbon-helix-helix domain-containing protein Antitoxin
JMV89_RS24285 6377..7129 + 753 WP_000562172.1 IclR family transcriptional regulator -
JMV89_RS24290 7175..8140 - 966 WP_001022265.1 2-keto-3-deoxygluconate transporter -
JMV89_RS24295 8173..8553 - 381 WP_000710783.1 Rid family detoxifying hydrolase -
JMV89_RS24300 8578..9468 - 891 WP_001077068.1 dihydrodipicolinate synthase family protein -
JMV89_RS24305 9701..9895 - 195 WP_000796505.1 hypothetical protein -
JMV89_RS24310 9869..10309 + 441 Protein_14 zinc-binding dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(B) / blaCTX-M-15 / sitABCD iucA / iucB / iucC / iucD / iutA 1..125802 125802


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 10.0871

>T290263 WP_000421272.1 NZ_LR890199:c5488-5213 [Escherichia coli]
MELKWTSKALSDLSRLFDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYEINGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10460.87 Da        Isoelectric Point: 5.6558

>AT290263 WP_001387467.1 NZ_LR890199:c5772-5488 [Escherichia coli]
MQMKNNAAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
SDSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0SVC8

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0Y880

References