Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 995188..995842 | Replicon | chromosome |
| Accession | NZ_LR890198 | ||
| Organism | Escherichia coli isolate MINF_1D-sc-2280456 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | JMV89_RS04760 | Protein ID | WP_000244781.1 |
| Coordinates | 995435..995842 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | JMV89_RS04755 | Protein ID | WP_000354046.1 |
| Coordinates | 995188..995454 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMV89_RS04735 | 991276..992709 | - | 1434 | WP_001350137.1 | 6-phospho-beta-glucosidase BglA | - |
| JMV89_RS04740 | 992754..993065 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
| JMV89_RS04745 | 993229..993888 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| JMV89_RS04750 | 993965..994945 | - | 981 | WP_000886078.1 | tRNA-modifying protein YgfZ | - |
| JMV89_RS04755 | 995188..995454 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| JMV89_RS04760 | 995435..995842 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| JMV89_RS04765 | 995882..996403 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| JMV89_RS04770 | 996515..997411 | + | 897 | WP_000806633.1 | site-specific tyrosine recombinase XerD | - |
| JMV89_RS04775 | 997436..998146 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| JMV89_RS04780 | 998152..999885 | + | 1734 | WP_000813193.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T290244 WP_000244781.1 NZ_LR890198:995435-995842 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|