Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/ElaA-DUF1778 |
Location | 71315..72054 | Replicon | plasmid 5 |
Accession | NZ_LR890193 | ||
Organism | Klebsiella pneumoniae isolate INF133-sc-2279960 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | J6I5J9 |
Locus tag | JMX29_RS28080 | Protein ID | WP_009653238.1 |
Coordinates | 71569..72054 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | J5VA20 |
Locus tag | JMX29_RS28075 | Protein ID | WP_009653219.1 |
Coordinates | 71315..71581 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX29_RS28045 | 66917..67675 | - | 759 | WP_023303135.1 | hypothetical protein | - |
JMX29_RS28050 | 67729..68649 | - | 921 | WP_009651631.1 | hypothetical protein | - |
JMX29_RS28055 | 68713..69084 | - | 372 | WP_029602876.1 | hypothetical protein | - |
JMX29_RS28060 | 69225..69914 | - | 690 | WP_009654088.1 | hypothetical protein | - |
JMX29_RS28065 | 69928..70665 | - | 738 | WP_009654087.1 | HupE/UreJ family protein | - |
JMX29_RS28070 | 70710..71075 | - | 366 | WP_029602878.1 | hypothetical protein | - |
JMX29_RS28075 | 71315..71581 | + | 267 | WP_009653219.1 | DUF1778 domain-containing protein | Antitoxin |
JMX29_RS28080 | 71569..72054 | + | 486 | WP_009653238.1 | GNAT family N-acetyltransferase | Toxin |
JMX29_RS28085 | 72354..73427 | - | 1074 | WP_048270288.1 | IS481 family transposase | - |
JMX29_RS28090 | 73488..73649 | + | 162 | WP_032426744.1 | type I toxin-antitoxin system Hok family toxin | - |
JMX29_RS28095 | 73810..74295 | - | 486 | WP_020277937.1 | hypothetical protein | - |
JMX29_RS28100 | 74485..74757 | + | 273 | WP_023280873.1 | hypothetical protein | - |
JMX29_RS28105 | 74754..75104 | + | 351 | WP_020277938.1 | hypothetical protein | - |
JMX29_RS28110 | 75621..76001 | + | 381 | WP_015632488.1 | hypothetical protein | - |
JMX29_RS28115 | 76067..76414 | + | 348 | WP_020316654.1 | hypothetical protein | - |
JMX29_RS28120 | 76502..76732 | + | 231 | WP_020805755.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | mcr-10 | - | 1..120029 | 120029 | |
- | flank | IS/Tn | - | - | 72354..73427 | 1073 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17756.43 Da Isoelectric Point: 9.9000
>T290241 WP_009653238.1 NZ_LR890193:71569-72054 [Klebsiella pneumoniae]
VGYVTSPEPLSSFHQVAEFISGEAVLDDWLKQRSLKNQATGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDVSFRGKGLGADLLHDAVLRCFRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQSQPRTLFLRLP
Q
VGYVTSPEPLSSFHQVAEFISGEAVLDDWLKQRSLKNQATGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDVSFRGKGLGADLLHDAVLRCFRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQSQPRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A142I4R1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A142I4R0 |