Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 38988..39631 Replicon plasmid 5
Accession NZ_LR890193
Organism Klebsiella pneumoniae isolate INF133-sc-2279960

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag JMX29_RS27865 Protein ID WP_001044770.1
Coordinates 38988..39404 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag JMX29_RS27870 Protein ID WP_001261282.1
Coordinates 39401..39631 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX29_RS27815 34539..35096 - 558 WP_003100847.1 recombinase family protein -
JMX29_RS27820 35090..35461 - 372 WP_003100853.1 hypothetical protein -
JMX29_RS27825 35458..35958 - 501 WP_003100856.1 hypothetical protein -
JMX29_RS27830 35955..36281 - 327 WP_003100858.1 hypothetical protein -
JMX29_RS27835 36536..36892 - 357 WP_003465043.1 cupin domain-containing protein -
JMX29_RS27840 36882..37283 - 402 WP_001293886.1 DUF86 domain-containing protein -
JMX29_RS27845 37280..37570 - 291 WP_001247892.1 nucleotidyltransferase -
JMX29_RS27850 37729..37896 + 168 Protein_41 DUF4158 domain-containing protein -
JMX29_RS27855 37960..38664 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
JMX29_RS27860 38750..38890 + 141 WP_045286941.1 helix-turn-helix domain-containing protein -
JMX29_RS27865 38988..39404 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
JMX29_RS27870 39401..39631 - 231 WP_001261282.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JMX29_RS27875 39588..40049 + 462 WP_201525304.1 hypothetical protein -
JMX29_RS27880 40219..40533 + 315 WP_047046586.1 hypothetical protein -
JMX29_RS27885 40593..41201 + 609 WP_072124307.1 hypothetical protein -
JMX29_RS27890 41267..42043 + 777 WP_072124298.1 site-specific integrase -
JMX29_RS27895 42101..42358 - 258 WP_153650515.1 hypothetical protein -
JMX29_RS27900 42904..43659 + 756 WP_012539983.1 replication initiation protein RepE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid mcr-10 - 1..120029 120029


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T290240 WP_001044770.1 NZ_LR890193:c39404-38988 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT290240 WP_001261282.1 NZ_LR890193:c39631-39401 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References