Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 54737..55473 Replicon plasmid 3
Accession NZ_LR890191
Organism Klebsiella pneumoniae isolate INF133-sc-2279960

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag JMX29_RS25535 Protein ID WP_003026803.1
Coordinates 54991..55473 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag JMX29_RS25530 Protein ID WP_003026799.1
Coordinates 54737..55003 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX29_RS25485 50937..51299 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
JMX29_RS25490 51349..51699 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
JMX29_RS25495 52057..52305 + 249 WP_019725036.1 hypothetical protein -
JMX29_RS25500 52302..52874 + 573 WP_015065504.1 hypothetical protein -
JMX29_RS25505 52905..53399 + 495 WP_009310053.1 hypothetical protein -
JMX29_RS25510 53443..53811 + 369 WP_015065502.1 hypothetical protein -
JMX29_RS25515 53845..54048 + 204 WP_019725040.1 hemolysin expression modulator Hha -
JMX29_RS25520 54062..54292 + 231 WP_019725034.1 hypothetical protein -
JMX29_RS25525 54336..54530 - 195 WP_019725033.1 hypothetical protein -
JMX29_RS25530 54737..55003 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
JMX29_RS25535 54991..55473 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
JMX29_RS25540 55681..57027 + 1347 WP_077253535.1 ISNCY family transposase -
JMX29_RS25545 57076..57471 + 396 WP_004143398.1 helix-turn-helix domain-containing protein -
JMX29_RS25550 57619..58873 - 1255 Protein_59 IS3 family transposase -
JMX29_RS25555 58961..59923 - 963 WP_004152113.1 M48 family metalloprotease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / dfrA14 / qnrB1 / tet(A) / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 - 1..245649 245649


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T290238 WP_003026803.1 NZ_LR890191:54991-55473 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT290238 WP_003026799.1 NZ_LR890191:54737-55003 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References