Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4675501..4676017 | Replicon | chromosome |
Accession | NZ_LR890189 | ||
Organism | Klebsiella pneumoniae isolate INF133-sc-2279960 |
Toxin (Protein)
Gene name | relE | Uniprot ID | J2XDK6 |
Locus tag | JMX29_RS22590 | Protein ID | WP_002886902.1 |
Coordinates | 4675501..4675785 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | JMX29_RS22595 | Protein ID | WP_002886901.1 |
Coordinates | 4675775..4676017 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX29_RS22565 | 4670918..4671226 | - | 309 | WP_004178377.1 | PTS sugar transporter subunit IIB | - |
JMX29_RS22570 | 4671311..4671484 | + | 174 | WP_004222159.1 | hypothetical protein | - |
JMX29_RS22575 | 4671487..4672230 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
JMX29_RS22580 | 4672587..4674725 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
JMX29_RS22585 | 4675033..4675497 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
JMX29_RS22590 | 4675501..4675785 | - | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMX29_RS22595 | 4675775..4676017 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
JMX29_RS22600 | 4676095..4678005 | - | 1911 | WP_040147048.1 | BglG family transcription antiterminator | - |
JMX29_RS22605 | 4678028..4679182 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
JMX29_RS22610 | 4679249..4679989 | - | 741 | WP_040147051.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T290235 WP_002886902.1 NZ_LR890189:c4675785-4675501 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GMH2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |