Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 55018..55754 Replicon plasmid 2
Accession NZ_LR890186
Organism Klebsiella pneumoniae isolate INF072-sc-2279995

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag JMV85_RS26360 Protein ID WP_003026803.1
Coordinates 55272..55754 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag JMV85_RS26355 Protein ID WP_003026799.1
Coordinates 55018..55284 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMV85_RS26310 51080..51442 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
JMV85_RS26315 51492..51842 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
JMV85_RS26320 52200..52469 + 270 WP_019706036.1 hypothetical protein -
JMV85_RS26325 52457..53032 + 576 WP_004152103.1 hypothetical protein -
JMV85_RS26330 53063..53557 + 495 WP_004152104.1 DNA-binding protein -
JMV85_RS26335 53601..53969 + 369 WP_004152105.1 hypothetical protein -
JMV85_RS26340 54003..54206 + 204 WP_004152106.1 hemolysin expression modulator Hha -
JMV85_RS26345 54255..54512 + 258 WP_004152107.1 hypothetical protein -
JMV85_RS26350 54588..54842 + 255 WP_004152108.1 hypothetical protein -
JMV85_RS26355 55018..55284 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
JMV85_RS26360 55272..55754 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
JMV85_RS26365 55955..57358 + 1404 WP_001567368.1 ISNCY-like element ISKpn21 family transposase -
JMV85_RS26370 57387..58019 - 633 WP_001567369.1 hypothetical protein -
JMV85_RS26375 58196..59450 - 1255 Protein_59 IS3 family transposase -
JMV85_RS26380 59538..60500 - 963 WP_004152113.1 M48 family metalloprotease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..239736 239736


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T290223 WP_003026803.1 NZ_LR890186:55272-55754 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT290223 WP_003026799.1 NZ_LR890186:55018-55284 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References