Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4800887..4801403 | Replicon | chromosome |
Accession | NZ_LR890185 | ||
Organism | Klebsiella pneumoniae isolate INF072-sc-2279995 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2A2BGN7 |
Locus tag | JMV85_RS23415 | Protein ID | WP_009486548.1 |
Coordinates | 4800887..4801171 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A331AB37 |
Locus tag | JMV85_RS23420 | Protein ID | WP_019704689.1 |
Coordinates | 4801161..4801403 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV85_RS23390 | 4796283..4796591 | - | 309 | WP_004186703.1 | PTS sugar transporter subunit IIB | - |
JMV85_RS23395 | 4796676..4796792 | + | 117 | WP_161477606.1 | hypothetical protein | - |
JMV85_RS23400 | 4796852..4797595 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
JMV85_RS23405 | 4797952..4800090 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
JMV85_RS23410 | 4800419..4800883 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
JMV85_RS23415 | 4800887..4801171 | - | 285 | WP_009486548.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMV85_RS23420 | 4801161..4801403 | - | 243 | WP_019704689.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
JMV85_RS23425 | 4801481..4803391 | - | 1911 | WP_004152270.1 | BglG family transcription antiterminator | - |
JMV85_RS23430 | 4803414..4804568 | - | 1155 | WP_019704690.1 | lactonase family protein | - |
JMV85_RS23435 | 4804635..4805375 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.4951
>T290220 WP_009486548.1 NZ_LR890185:c4801171-4800887 [Klebsiella pneumoniae]
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A2BGN7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A331AB37 |