Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4086036..4086655 Replicon chromosome
Accession NZ_LR890185
Organism Klebsiella pneumoniae isolate INF072-sc-2279995

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag JMV85_RS20075 Protein ID WP_002892050.1
Coordinates 4086437..4086655 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag JMV85_RS20070 Protein ID WP_002892066.1
Coordinates 4086036..4086410 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMV85_RS20060 4081188..4082381 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
JMV85_RS20065 4082404..4085550 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
JMV85_RS20070 4086036..4086410 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
JMV85_RS20075 4086437..4086655 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
JMV85_RS20080 4086814..4087380 + 567 WP_002892030.1 maltose O-acetyltransferase -
JMV85_RS20085 4087352..4087492 - 141 WP_032409038.1 hypothetical protein -
JMV85_RS20090 4087513..4087983 + 471 WP_002892026.1 YlaC family protein -
JMV85_RS20095 4087958..4089364 - 1407 WP_004167590.1 PLP-dependent aminotransferase family protein -
JMV85_RS20100 4089509..4090207 + 699 WP_019705329.1 GNAT family N-acetyltransferase -
JMV85_RS20105 4090204..4090344 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
JMV85_RS20110 4090344..4090607 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T290218 WP_002892050.1 NZ_LR890185:4086437-4086655 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT290218 WP_002892066.1 NZ_LR890185:4086036-4086410 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References