Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4598624..4599140 | Replicon | chromosome |
| Accession | NZ_LR890184 | ||
| Organism | Klebsiella aerogenes isolate MINF_10B-sc-2280448 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A837JS79 |
| Locus tag | JMV66_RS21920 | Protein ID | WP_045378458.1 |
| Coordinates | 4598624..4598908 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | JMV66_RS21925 | Protein ID | WP_002886901.1 |
| Coordinates | 4598898..4599140 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMV66_RS21900 | 4594039..4594347 | - | 309 | WP_020079792.1 | PTS sugar transporter subunit IIB | - |
| JMV66_RS21905 | 4594609..4595352 | + | 744 | WP_045378461.1 | MurR/RpiR family transcriptional regulator | - |
| JMV66_RS21910 | 4595710..4597848 | + | 2139 | WP_015368566.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| JMV66_RS21915 | 4598156..4598620 | + | 465 | WP_015368567.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| JMV66_RS21920 | 4598624..4598908 | - | 285 | WP_045378458.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JMV66_RS21925 | 4598898..4599140 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| JMV66_RS21930 | 4599218..4601128 | - | 1911 | WP_047040166.1 | BglG family transcription antiterminator | - |
| JMV66_RS21935 | 4601151..4602302 | - | 1152 | WP_047040164.1 | lactonase family protein | - |
| JMV66_RS21940 | 4602369..4603109 | - | 741 | WP_110884137.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11145.05 Da Isoelectric Point: 10.3787
>T290208 WP_045378458.1 NZ_LR890184:c4598908-4598624 [Klebsiella aerogenes]
MTYELEFDPRAWREWQKLGETVKKQFKNKLLQIVQNPRMESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKLGETVKKQFKNKLLQIVQNPRMESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837JS79 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |