Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3830801..3831420 | Replicon | chromosome |
Accession | NZ_LR890184 | ||
Organism | Klebsiella aerogenes isolate MINF_10B-sc-2280448 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A0H3FXE2 |
Locus tag | JMV66_RS18370 | Protein ID | WP_015367918.1 |
Coordinates | 3831202..3831420 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A837JQD8 |
Locus tag | JMV66_RS18365 | Protein ID | WP_045381144.1 |
Coordinates | 3830801..3831175 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV66_RS18355 | 3825956..3827155 | + | 1200 | WP_020079451.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
JMV66_RS18360 | 3827178..3830324 | + | 3147 | WP_015704610.1 | multidrug efflux RND transporter permease subunit | - |
JMV66_RS18365 | 3830801..3831175 | + | 375 | WP_045381144.1 | Hha toxicity modulator TomB | Antitoxin |
JMV66_RS18370 | 3831202..3831420 | + | 219 | WP_015367918.1 | hemolysin expression modulator Hha | Toxin |
JMV66_RS18375 | 3831552..3832115 | + | 564 | WP_201506873.1 | maltose O-acetyltransferase | - |
JMV66_RS18380 | 3832241..3832705 | + | 465 | WP_015367920.1 | YlaC family protein | - |
JMV66_RS18385 | 3832680..3834134 | - | 1455 | WP_045381138.1 | PLP-dependent aminotransferase family protein | - |
JMV66_RS18390 | 3834237..3834947 | + | 711 | WP_045381136.1 | GNAT family N-acetyltransferase | - |
JMV66_RS18395 | 3834944..3835084 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
JMV66_RS18400 | 3835087..3835347 | - | 261 | WP_015367923.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8569.96 Da Isoelectric Point: 9.4828
>T290207 WP_015367918.1 NZ_LR890184:3831202-3831420 [Klebsiella aerogenes]
MSGKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSGKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14519.28 Da Isoelectric Point: 4.9045
>AT290207 WP_045381144.1 NZ_LR890184:3830801-3831175 [Klebsiella aerogenes]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNRGWVNDPTSAVNLQLNELIEHIATYALNYKIKYAEDNKLISQLDEYL
DDTFMLFSSYGINTNDLQKWRKSGNRLFRCFVNASRENPVSLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNRGWVNDPTSAVNLQLNELIEHIATYALNYKIKYAEDNKLISQLDEYL
DDTFMLFSSYGINTNDLQKWRKSGNRLFRCFVNASRENPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3FXE2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837JQD8 |