Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2578619..2579358 | Replicon | chromosome |
| Accession | NZ_LR890184 | ||
| Organism | Klebsiella aerogenes isolate MINF_10B-sc-2280448 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A7D7FM44 |
| Locus tag | JMV66_RS12395 | Protein ID | WP_026612320.1 |
| Coordinates | 2578873..2579358 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | - |
| Locus tag | JMV66_RS12390 | Protein ID | WP_141238152.1 |
| Coordinates | 2578619..2578885 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMV66_RS12370 | 2574902..2575519 | + | 618 | WP_201506736.1 | response regulator | - |
| JMV66_RS12375 | 2575615..2576112 | + | 498 | WP_141238151.1 | heme-binding protein | - |
| JMV66_RS12380 | 2576527..2577057 | + | 531 | WP_047041122.1 | N-acetyltransferase | - |
| JMV66_RS12385 | 2577112..2578347 | - | 1236 | WP_182014895.1 | MFS transporter | - |
| JMV66_RS12390 | 2578619..2578885 | + | 267 | WP_141238152.1 | DUF1778 domain-containing protein | Antitoxin |
| JMV66_RS12395 | 2578873..2579358 | + | 486 | WP_026612320.1 | GNAT family N-acetyltransferase | Toxin |
| JMV66_RS12400 | 2579430..2581046 | + | 1617 | WP_182014897.1 | FAD-NAD(P)-binding protein | - |
| JMV66_RS12405 | 2581165..2582265 | + | 1101 | WP_141238153.1 | NADH:flavin oxidoreductase/NADH oxidase | - |
| JMV66_RS12410 | 2582322..2582480 | - | 159 | WP_002903230.1 | YqaE/Pmp3 family membrane protein | - |
| JMV66_RS12415 | 2582741..2583811 | + | 1071 | WP_141238154.1 | mannonate dehydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17591.26 Da Isoelectric Point: 8.8793
>T290206 WP_026612320.1 NZ_LR890184:2578873-2579358 [Klebsiella aerogenes]
MGKISAPAPLSSHHQIAEFCCGETVLDQWLKQRGMKNQAQGAARTFVVCKEDSHQVVGFYSLATGSVNHTEATGGLRRNM
PDPIPVIILARLAIDCAFHGQGLGADLLHDALLRSYRVAENVGVRALMVHALTDSAKRFYLHHGFKASTTQERTLFLALP
K
MGKISAPAPLSSHHQIAEFCCGETVLDQWLKQRGMKNQAQGAARTFVVCKEDSHQVVGFYSLATGSVNHTEATGGLRRNM
PDPIPVIILARLAIDCAFHGQGLGADLLHDALLRSYRVAENVGVRALMVHALTDSAKRFYLHHGFKASTTQERTLFLALP
K
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|