Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 53481..54124 | Replicon | plasmid 2 |
Accession | NZ_LR890182 | ||
Organism | Citrobacter freundii isolate MSB1_1H-sc-2280393 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | JMV71_RS23880 | Protein ID | WP_121572286.1 |
Coordinates | 53481..53897 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | - |
Locus tag | JMV71_RS23885 | Protein ID | WP_121572285.1 |
Coordinates | 53894..54124 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV71_RS23860 | 48790..49548 | + | 759 | WP_047732337.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
JMV71_RS23865 | 49582..50763 | + | 1182 | WP_121572288.1 | MFS transporter | - |
JMV71_RS23870 | 50845..51474 | + | 630 | WP_063136851.1 | DUF1349 domain-containing protein | - |
JMV71_RS23875 | 52265..53335 | + | 1071 | WP_141227224.1 | hypothetical protein | - |
JMV71_RS23880 | 53481..53897 | - | 417 | WP_121572286.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JMV71_RS23885 | 53894..54124 | - | 231 | WP_121572285.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
JMV71_RS23890 | 54398..55423 | + | 1026 | WP_121572284.1 | hypothetical protein | - |
JMV71_RS23895 | 55471..56409 | - | 939 | WP_121572283.1 | hypothetical protein | - |
JMV71_RS23900 | 56981..57292 | + | 312 | WP_121572282.1 | hypothetical protein | - |
JMV71_RS23905 | 57381..57743 | + | 363 | WP_121572281.1 | hypothetical protein | - |
JMV71_RS23910 | 57758..58114 | + | 357 | WP_121572348.1 | hypothetical protein | - |
JMV71_RS23915 | 58111..58890 | + | 780 | WP_201506622.1 | site-specific integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..135529 | 135529 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15133.65 Da Isoelectric Point: 6.2225
>T290199 WP_121572286.1 NZ_LR890182:c53897-53481 [Citrobacter freundii]
VNKTYMLDTCICSFIMREQPEAVLKHLEQAVLRNQRIVIPVITYAEMRFGATGPKVSPRHIELVDAFCARLDAILPWDSA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAAGVVLVTNNVREFERVPGLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKHLEQAVLRNQRIVIPVITYAEMRFGATGPKVSPRHIELVDAFCARLDAILPWDSA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAAGVVLVTNNVREFERVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|