Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4733251..4733867 | Replicon | chromosome |
| Accession | NZ_LR890181 | ||
| Organism | Citrobacter freundii isolate MSB1_1H-sc-2280393 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A0J1MQ96 |
| Locus tag | JMV71_RS22780 | Protein ID | WP_003028682.1 |
| Coordinates | 4733251..4733625 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A6B5NTK4 |
| Locus tag | JMV71_RS22785 | Protein ID | WP_043018956.1 |
| Coordinates | 4733625..4733867 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMV71_RS22765 | 4730754..4731656 | + | 903 | WP_106107909.1 | formate dehydrogenase O subunit beta | - |
| JMV71_RS22770 | 4731653..4732288 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
| JMV71_RS22775 | 4732285..4733214 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
| JMV71_RS22780 | 4733251..4733625 | - | 375 | WP_003028682.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JMV71_RS22785 | 4733625..4733867 | - | 243 | WP_043018956.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| JMV71_RS22790 | 4734073..4734981 | + | 909 | WP_119174684.1 | alpha/beta hydrolase | - |
| JMV71_RS22795 | 4735132..4736073 | - | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
| JMV71_RS22800 | 4736118..4736555 | - | 438 | WP_003028671.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| JMV71_RS22805 | 4736552..4737424 | - | 873 | WP_003840437.1 | virulence factor BrkB family protein | - |
| JMV71_RS22810 | 4737418..4738017 | - | 600 | WP_016151258.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13674.89 Da Isoelectric Point: 9.5622
>T290198 WP_003028682.1 NZ_LR890181:c4733625-4733251 [Citrobacter freundii]
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1MQ96 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6B5NTK4 |