Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4325993..4326509 | Replicon | chromosome |
Accession | NZ_LR890181 | ||
Organism | Citrobacter freundii isolate MSB1_1H-sc-2280393 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0D7LMW6 |
Locus tag | JMV71_RS20880 | Protein ID | WP_003839578.1 |
Coordinates | 4325993..4326277 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0J1MV10 |
Locus tag | JMV71_RS20885 | Protein ID | WP_003839576.1 |
Coordinates | 4326267..4326509 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV71_RS20865 | 4322240..4322824 | + | 585 | WP_200020370.1 | fructose PTS transporter subunit IIA | - |
JMV71_RS20870 | 4323202..4325340 | + | 2139 | WP_003025782.1 | anaerobic ribonucleoside-triphosphate reductase | - |
JMV71_RS20875 | 4325525..4325989 | + | 465 | WP_032937736.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
JMV71_RS20880 | 4325993..4326277 | - | 285 | WP_003839578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMV71_RS20885 | 4326267..4326509 | - | 243 | WP_003839576.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
JMV71_RS20890 | 4326587..4328500 | - | 1914 | WP_003844930.1 | BglG family transcription antiterminator | - |
JMV71_RS20895 | 4328522..4329262 | - | 741 | WP_003025772.1 | KDGP aldolase family protein | - |
JMV71_RS20900 | 4329259..4330377 | - | 1119 | WP_048219848.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
JMV71_RS20905 | 4330361..4331494 | - | 1134 | WP_016149471.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10866.68 Da Isoelectric Point: 10.0482
>T290197 WP_003839578.1 NZ_LR890181:c4326277-4325993 [Citrobacter freundii]
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVTVFVVAVGK
REHSAVYLDANKRL
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVTVFVVAVGK
REHSAVYLDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D7LMW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1MV10 |