Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3655434..3656054 Replicon chromosome
Accession NZ_LR890181
Organism Citrobacter freundii isolate MSB1_1H-sc-2280393

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag JMV71_RS17810 Protein ID WP_002892050.1
Coordinates 3655836..3656054 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID R8WZW8
Locus tag JMV71_RS17805 Protein ID WP_003021733.1
Coordinates 3655434..3655808 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMV71_RS17795 3650580..3651773 + 1194 WP_003835922.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
JMV71_RS17800 3651796..3654945 + 3150 WP_003021736.1 multidrug efflux RND transporter permease subunit -
JMV71_RS17805 3655434..3655808 + 375 WP_003021733.1 Hha toxicity modulator TomB Antitoxin
JMV71_RS17810 3655836..3656054 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
JMV71_RS17815 3656361..3656912 + 552 WP_003835924.1 maltose O-acetyltransferase -
JMV71_RS17820 3657029..3657499 + 471 WP_087879033.1 YlaC family protein -
JMV71_RS17825 3657578..3657718 - 141 WP_005125190.1 type B 50S ribosomal protein L36 -
JMV71_RS17830 3657720..3657980 - 261 WP_003021719.1 type B 50S ribosomal protein L31 -
JMV71_RS17835 3658169..3659722 + 1554 WP_201506428.1 EAL domain-containing protein -
JMV71_RS17840 3659774..3660127 - 354 WP_003831033.1 DUF1428 family protein -
JMV71_RS17845 3660192..3660821 - 630 WP_003835929.1 membrane protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T290196 WP_002892050.1 NZ_LR890181:3655836-3656054 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14427.23 Da        Isoelectric Point: 5.5653

>AT290196 WP_003021733.1 NZ_LR890181:3655434-3655808 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB R8WZW8

References