Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3655434..3656054 | Replicon | chromosome |
Accession | NZ_LR890181 | ||
Organism | Citrobacter freundii isolate MSB1_1H-sc-2280393 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | JMV71_RS17810 | Protein ID | WP_002892050.1 |
Coordinates | 3655836..3656054 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | R8WZW8 |
Locus tag | JMV71_RS17805 | Protein ID | WP_003021733.1 |
Coordinates | 3655434..3655808 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV71_RS17795 | 3650580..3651773 | + | 1194 | WP_003835922.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
JMV71_RS17800 | 3651796..3654945 | + | 3150 | WP_003021736.1 | multidrug efflux RND transporter permease subunit | - |
JMV71_RS17805 | 3655434..3655808 | + | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
JMV71_RS17810 | 3655836..3656054 | + | 219 | WP_002892050.1 | hemolysin expression modulator Hha | Toxin |
JMV71_RS17815 | 3656361..3656912 | + | 552 | WP_003835924.1 | maltose O-acetyltransferase | - |
JMV71_RS17820 | 3657029..3657499 | + | 471 | WP_087879033.1 | YlaC family protein | - |
JMV71_RS17825 | 3657578..3657718 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
JMV71_RS17830 | 3657720..3657980 | - | 261 | WP_003021719.1 | type B 50S ribosomal protein L31 | - |
JMV71_RS17835 | 3658169..3659722 | + | 1554 | WP_201506428.1 | EAL domain-containing protein | - |
JMV71_RS17840 | 3659774..3660127 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
JMV71_RS17845 | 3660192..3660821 | - | 630 | WP_003835929.1 | membrane protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T290196 WP_002892050.1 NZ_LR890181:3655836-3656054 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT290196 WP_003021733.1 NZ_LR890181:3655434-3655808 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | R8WZW8 |