Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 1185958..1186625 | Replicon | chromosome |
| Accession | NZ_LR890181 | ||
| Organism | Citrobacter freundii isolate MSB1_1H-sc-2280393 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | A0A4Q2R4P3 |
| Locus tag | JMV71_RS05685 | Protein ID | WP_032733644.1 |
| Coordinates | 1185958..1186287 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | JMV71_RS05690 | Protein ID | WP_119174477.1 |
| Coordinates | 1186308..1186625 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMV71_RS05680 | 1181689..1185231 | - | 3543 | WP_119174478.1 | inverse autotransporter beta domain-containing protein | - |
| JMV71_RS05685 | 1185958..1186287 | - | 330 | WP_032733644.1 | TA system toxin CbtA family protein | Toxin |
| JMV71_RS05690 | 1186308..1186625 | - | 318 | WP_119174477.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| JMV71_RS05695 | 1186644..1186865 | - | 222 | WP_047028248.1 | DUF987 domain-containing protein | - |
| JMV71_RS05700 | 1186874..1187356 | - | 483 | WP_087900482.1 | RadC family protein | - |
| JMV71_RS05705 | 1187365..1187823 | - | 459 | WP_119174476.1 | antirestriction protein | - |
| JMV71_RS05710 | 1187909..1188145 | - | 237 | WP_048339400.1 | DUF905 domain-containing protein | - |
| JMV71_RS05715 | 1188223..1188633 | - | 411 | WP_119174475.1 | hypothetical protein | - |
| JMV71_RS05720 | 1188700..1189137 | - | 438 | WP_057059560.1 | hypothetical protein | - |
| JMV71_RS05725 | 1189179..1189715 | - | 537 | WP_064279067.1 | DUF4339 domain-containing protein | - |
| JMV71_RS05730 | 1189741..1190451 | - | 711 | WP_119174474.1 | DeoR family transcriptional regulator | - |
| JMV71_RS05735 | 1190660..1191484 | - | 825 | WP_119174473.1 | DUF945 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12353.33 Da Isoelectric Point: 9.5741
>T290189 WP_032733644.1 NZ_LR890181:c1186287-1185958 [Citrobacter freundii]
MKTLPATISRATKPCLSPVAVWQMLLTHLLEQHYGLTLNDTPFSDKTVIQEHINAGVSLSDAVNFLVEKYELVRIDRKGF
SWQEQTPYISVVDILRARRSTGLLKTNVK
MKTLPATISRATKPCLSPVAVWQMLLTHLLEQHYGLTLNDTPFSDKTVIQEHINAGVSLSDAVNFLVEKYELVRIDRKGF
SWQEQTPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|