Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 251960..252591 | Replicon | chromosome |
Accession | NZ_LR890181 | ||
Organism | Citrobacter freundii isolate MSB1_1H-sc-2280393 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | JMV71_RS01165 | Protein ID | WP_201506468.1 |
Coordinates | 251960..252235 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A0J1MMS0 |
Locus tag | JMV71_RS01170 | Protein ID | WP_003837808.1 |
Coordinates | 252232..252591 (+) | Length | 120 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV71_RS01155 | 248011..250758 | + | 2748 | WP_032937231.1 | ribosome-associated ATPase/putative transporter RbbA | - |
JMV71_RS01160 | 250758..251882 | + | 1125 | WP_003837801.1 | ABC transporter permease | - |
JMV71_RS01165 | 251960..252235 | + | 276 | WP_201506468.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
JMV71_RS01170 | 252232..252591 | + | 360 | WP_003837808.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
JMV71_RS01175 | 252704..253105 | - | 402 | WP_003023387.1 | nickel-responsive transcriptional regulator NikR | - |
JMV71_RS01180 | 253155..253733 | - | 579 | WP_003837810.1 | 4'-phosphopantetheinyl transferase AcpT | - |
JMV71_RS01185 | 253796..254845 | - | 1050 | WP_003023393.1 | AI-2E family transporter | - |
JMV71_RS01190 | 254979..256196 | + | 1218 | WP_016151126.1 | MFS transporter | - |
JMV71_RS01195 | 256200..256757 | - | 558 | WP_003837816.1 | DcrB family lipoprotein | - |
JMV71_RS01200 | 256830..257495 | - | 666 | WP_119174639.1 | 7-cyano-7-deazaguanine/7-aminomethyl-7- deazaguanine transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10152.85 Da Isoelectric Point: 10.8528
>T290186 WP_201506468.1 NZ_LR890181:251960-252235 [Citrobacter freundii]
MKEKVLSLRKKQKNTLDQLFKAPTPQGIKWSEIESLIKALGGEIKEGRGSRCKFLLNKSIASFHRPHPSPDTDKGAVENV
RGWLTSIGVKP
MKEKVLSLRKKQKNTLDQLFKAPTPQGIKWSEIESLIKALGGEIKEGRGSRCKFLLNKSIASFHRPHPSPDTDKGAVENV
RGWLTSIGVKP
Download Length: 276 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13198.98 Da Isoelectric Point: 4.5462
>AT290186 WP_003837808.1 NZ_LR890181:252232-252591 [Citrobacter freundii]
MIKPKTPNSMEIAGQPAVINYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGEISLREYLDDCSAAGIEPYANPEKLKT
FTLRYPESFGERLSFAAAEEQVSVNTWIIETLSKSLKQA
MIKPKTPNSMEIAGQPAVINYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGEISLREYLDDCSAAGIEPYANPEKLKT
FTLRYPESFGERLSFAAAEEQVSVNTWIIETLSKSLKQA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|