Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 74685..75286 | Replicon | plasmid 2 |
Accession | NZ_LR883966 | ||
Organism | Escherichia coli isolate 2016-17-550 |
Toxin (Protein)
Gene name | doc | Uniprot ID | U9YA20 |
Locus tag | JMV10_RS22845 | Protein ID | WP_001216045.1 |
Coordinates | 74685..75065 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | JMV10_RS22850 | Protein ID | WP_001190712.1 |
Coordinates | 75065..75286 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV10_RS22820 | 70893..71777 | - | 885 | WP_000058717.1 | EamA family transporter | - |
JMV10_RS22825 | 71915..72322 | - | 408 | WP_001214976.1 | cysteine hydrolase | - |
JMV10_RS22830 | 72311..74062 | + | 1752 | Protein_75 | Tn3-like element TnAs1 family transposase | - |
JMV10_RS22835 | 74096..74473 | - | 378 | Protein_76 | hypothetical protein | - |
JMV10_RS22840 | 74501..74680 | - | 180 | WP_000113019.1 | hypothetical protein | - |
JMV10_RS22845 | 74685..75065 | - | 381 | WP_001216045.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
JMV10_RS22850 | 75065..75286 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
JMV10_RS22855 | 75469..77025 | + | 1557 | WP_016231378.1 | type I restriction-modification system subunit M | - |
JMV10_RS22860 | 77022..78257 | + | 1236 | WP_059338147.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | qnrS1 / blaTEM-1B / tet(A) | - | 1..104732 | 104732 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13588.29 Da Isoelectric Point: 5.1514
>T290185 WP_001216045.1 NZ_LR883966:c75065-74685 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CLP7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |