Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 4310978..4311603 | Replicon | chromosome |
Accession | NZ_LR883965 | ||
Organism | Escherichia coli isolate 2016-17-550 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U9YZ02 |
Locus tag | JMV10_RS20610 | Protein ID | WP_000911329.1 |
Coordinates | 4311205..4311603 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | JMV10_RS20605 | Protein ID | WP_000450524.1 |
Coordinates | 4310978..4311205 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV10_RS20580 | 4306780..4307250 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
JMV10_RS20585 | 4307250..4307822 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
JMV10_RS20590 | 4307968..4308846 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
JMV10_RS20595 | 4308863..4309897 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
JMV10_RS20600 | 4310110..4310823 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
JMV10_RS20605 | 4310978..4311205 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
JMV10_RS20610 | 4311205..4311603 | + | 399 | WP_000911329.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
JMV10_RS20615 | 4311750..4312613 | + | 864 | WP_201488683.1 | neutral zinc metallopeptidase | - |
JMV10_RS20620 | 4312628..4314643 | + | 2016 | WP_032254558.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
JMV10_RS20625 | 4314717..4315415 | + | 699 | WP_000679823.1 | esterase | - |
JMV10_RS20630 | 4315525..4315725 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T290183 WP_000911329.1 NZ_LR883965:4311205-4311603 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XW84 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CM33 |