Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 1728400..1729237 | Replicon | chromosome |
Accession | NZ_LR883965 | ||
Organism | Escherichia coli isolate 2016-17-550 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | JMV10_RS08300 | Protein ID | WP_000227784.1 |
Coordinates | 1728695..1729237 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | A0A3T7ZCX8 |
Locus tag | JMV10_RS08295 | Protein ID | WP_001442339.1 |
Coordinates | 1728400..1728711 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV10_RS08270 | 1723420..1724367 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
JMV10_RS08275 | 1724389..1726380 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
JMV10_RS08280 | 1726370..1726984 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
JMV10_RS08285 | 1726984..1727313 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
JMV10_RS08290 | 1727325..1728215 | + | 891 | WP_000971336.1 | heme o synthase | - |
JMV10_RS08295 | 1728400..1728711 | + | 312 | WP_001442339.1 | DUF1778 domain-containing protein | Antitoxin |
JMV10_RS08300 | 1728695..1729237 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
JMV10_RS08305 | 1729293..1730228 | - | 936 | WP_001365761.1 | sel1 repeat family protein | - |
JMV10_RS08310 | 1730636..1732000 | + | 1365 | WP_001000978.1 | MFS transporter | - |
JMV10_RS08315 | 1732128..1732619 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
JMV10_RS08320 | 1732787..1733698 | + | 912 | WP_000705849.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T290173 WP_000227784.1 NZ_LR883965:1728695-1729237 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|