Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 675689..676327 | Replicon | chromosome |
| Accession | NZ_LR883965 | ||
| Organism | Escherichia coli isolate 2016-17-550 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | JMV10_RS03275 | Protein ID | WP_000813794.1 |
| Coordinates | 676151..676327 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | JMV10_RS03270 | Protein ID | WP_001270285.1 |
| Coordinates | 675689..676105 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMV10_RS03250 | 670841..671782 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
| JMV10_RS03255 | 671783..672796 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| JMV10_RS03260 | 672814..673959 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
| JMV10_RS03265 | 674204..675610 | - | 1407 | WP_000760589.1 | PLP-dependent aminotransferase family protein | - |
| JMV10_RS03270 | 675689..676105 | - | 417 | WP_001270285.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| JMV10_RS03275 | 676151..676327 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| JMV10_RS03280 | 676549..676779 | + | 231 | Protein_644 | DUF2554 family protein | - |
| JMV10_RS03285 | 676871..678832 | - | 1962 | WP_032255020.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| JMV10_RS03290 | 678905..679441 | - | 537 | WP_000429141.1 | DNA-binding transcriptional regulator SutR | - |
| JMV10_RS03295 | 679494..680708 | + | 1215 | WP_071601296.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T290171 WP_000813794.1 NZ_LR883965:c676327-676151 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15247.61 Da Isoelectric Point: 4.6115
>AT290171 WP_001270285.1 NZ_LR883965:c676105-675689 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFDLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFDLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|