Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 33069..33712 | Replicon | plasmid 4 |
| Accession | NZ_LR883053 | ||
| Organism | Escherichia coli isolate L1_E925 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q2VNX7 |
| Locus tag | JL017_RS24950 | Protein ID | WP_001044769.1 |
| Coordinates | 33069..33485 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D2WFK3 |
| Locus tag | JL017_RS24955 | Protein ID | WP_001261287.1 |
| Coordinates | 33482..33712 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JL017_RS24925 | 28543..28761 | + | 219 | Protein_35 | helix-turn-helix domain-containing protein | - |
| JL017_RS24930 | 28709..29092 | - | 384 | WP_000762576.1 | hypothetical protein | - |
| JL017_RS24935 | 29211..29558 | + | 348 | WP_000142434.1 | hypothetical protein | - |
| JL017_RS24940 | 29576..30166 | - | 591 | WP_012000738.1 | hypothetical protein | - |
| JL017_RS24945 | 30769..32907 | + | 2139 | WP_000350636.1 | AAA family ATPase | - |
| JL017_RS24950 | 33069..33485 | - | 417 | WP_001044769.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JL017_RS24955 | 33482..33712 | - | 231 | WP_001261287.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| JL017_RS24960 | 34271..34684 | + | 414 | WP_000465043.1 | hypothetical protein | - |
| JL017_RS24965 | 34686..35471 | + | 786 | WP_001164207.1 | site-specific integrase | - |
| JL017_RS24970 | 36073..36705 | + | 633 | WP_000312331.1 | ParA family protein | - |
| JL017_RS24975 | 36705..37079 | + | 375 | WP_000752652.1 | hypothetical protein | - |
| JL017_RS24980 | 37318..38292 | + | 975 | WP_001217833.1 | hypothetical protein | - |
| JL017_RS24985 | 38296..38688 | + | 393 | WP_000272015.1 | plasmid partitioning/stability family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | csbB / cooA / csbC / csdC / csbD | 1..82314 | 82314 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15183.63 Da Isoelectric Point: 7.7805
>T290163 WP_001044769.1 NZ_LR883053:c33485-33069 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKVKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKVKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A7ZGW5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QFC4 |