Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 33069..33712 Replicon plasmid 4
Accession NZ_LR883053
Organism Escherichia coli isolate L1_E925

Toxin (Protein)


Gene name vagD Uniprot ID Q2VNX7
Locus tag JL017_RS24950 Protein ID WP_001044769.1
Coordinates 33069..33485 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D2WFK3
Locus tag JL017_RS24955 Protein ID WP_001261287.1
Coordinates 33482..33712 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JL017_RS24925 28543..28761 + 219 Protein_35 helix-turn-helix domain-containing protein -
JL017_RS24930 28709..29092 - 384 WP_000762576.1 hypothetical protein -
JL017_RS24935 29211..29558 + 348 WP_000142434.1 hypothetical protein -
JL017_RS24940 29576..30166 - 591 WP_012000738.1 hypothetical protein -
JL017_RS24945 30769..32907 + 2139 WP_000350636.1 AAA family ATPase -
JL017_RS24950 33069..33485 - 417 WP_001044769.1 type II toxin-antitoxin system VapC family toxin Toxin
JL017_RS24955 33482..33712 - 231 WP_001261287.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JL017_RS24960 34271..34684 + 414 WP_000465043.1 hypothetical protein -
JL017_RS24965 34686..35471 + 786 WP_001164207.1 site-specific integrase -
JL017_RS24970 36073..36705 + 633 WP_000312331.1 ParA family protein -
JL017_RS24975 36705..37079 + 375 WP_000752652.1 hypothetical protein -
JL017_RS24980 37318..38292 + 975 WP_001217833.1 hypothetical protein -
JL017_RS24985 38296..38688 + 393 WP_000272015.1 plasmid partitioning/stability family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - csbB / cooA / csbC / csdC / csbD 1..82314 82314


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15183.63 Da        Isoelectric Point: 7.7805

>T290163 WP_001044769.1 NZ_LR883053:c33485-33069 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKVKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8815.90 Da        Isoelectric Point: 4.3775

>AT290163 WP_001261287.1 NZ_LR883053:c33712-33482 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLEYEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A7ZGW5

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9QFC4

References