Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 19344..19869 Replicon plasmid 2
Accession NZ_LR883051
Organism Escherichia coli isolate L1_E925

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag JL017_RS23675 Protein ID WP_001159871.1
Coordinates 19564..19869 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID D7GK94
Locus tag JL017_RS23670 Protein ID WP_000829078.1
Coordinates 19344..19562 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JL017_RS23645 14913..15862 - 950 Protein_18 virulence factor VirK -
JL017_RS23650 15867..16955 - 1089 WP_004100285.1 putative hexosyltransferase CapU -
JL017_RS23655 16958..17800 - 843 WP_160371899.1 polysaccharide deacetylase family protein -
JL017_RS23660 18044..18565 - 522 WP_044307843.1 hypothetical protein -
JL017_RS23665 18565..18822 - 258 WP_000343095.1 hypothetical protein -
JL017_RS23670 19344..19562 + 219 WP_000829078.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
JL017_RS23675 19564..19869 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
JL017_RS23680 19870..20676 + 807 WP_000016960.1 site-specific integrase -
JL017_RS23685 20854..21498 + 645 WP_001144037.1 ParA family protein -
JL017_RS23690 21585..21893 + 309 WP_000030204.1 molecular chaperone GroEL -
JL017_RS23695 22137..23708 - 1572 WP_024181021.1 IS66 family transposase -
JL017_RS23700 23728..24075 - 348 WP_000624622.1 IS66 family insertion sequence element accessory protein TnpB -
JL017_RS23705 24075..24752 - 678 WP_001704819.1 IS66-like element accessory protein TnpA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - cs3 / etpB / eltA / eltB 1..116803 116803


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T290162 WP_001159871.1 NZ_LR883051:19564-19869 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8440.51 Da        Isoelectric Point: 6.3212

>AT290162 WP_000829078.1 NZ_LR883051:19344-19562 [Escherichia coli]
MKRRITVTVDSDSYQLLKAYDVNISGLVSTIMQNEARRLRAERWKAENREGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A7ZGP5

References