Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3563259..3563877 | Replicon | chromosome |
| Accession | NZ_LR883050 | ||
| Organism | Escherichia coli isolate L1_E925 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | JL017_RS17335 | Protein ID | WP_001291435.1 |
| Coordinates | 3563659..3563877 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | JL017_RS17330 | Protein ID | WP_000344789.1 |
| Coordinates | 3563259..3563633 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JL017_RS17320 | 3558348..3559541 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| JL017_RS17325 | 3559564..3562713 | + | 3150 | WP_001132469.1 | multidrug efflux RND transporter permease subunit | - |
| JL017_RS17330 | 3563259..3563633 | + | 375 | WP_000344789.1 | Hha toxicity modulator TomB | Antitoxin |
| JL017_RS17335 | 3563659..3563877 | + | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
| JL017_RS17340 | 3564049..3564600 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| JL017_RS17345 | 3564716..3565186 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| JL017_RS17350 | 3565350..3566900 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| JL017_RS17355 | 3566942..3567295 | - | 354 | WP_000878143.1 | DUF1428 domain-containing protein | - |
| JL017_RS17365 | 3567674..3567985 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| JL017_RS17370 | 3568016..3568588 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T290157 WP_001291435.1 NZ_LR883050:3563659-3563877 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14569.44 Da Isoelectric Point: 4.7395
>AT290157 WP_000344789.1 NZ_LR883050:3563259-3563633 [Escherichia coli]
MDEYSPKRHDIAQLKFLCEILYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCEILYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|