Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2538529..2539167 | Replicon | chromosome |
| Accession | NZ_LR883050 | ||
| Organism | Escherichia coli isolate L1_E925 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | JL017_RS12260 | Protein ID | WP_000813794.1 |
| Coordinates | 2538991..2539167 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | JL017_RS12255 | Protein ID | WP_001270286.1 |
| Coordinates | 2538529..2538945 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JL017_RS12235 | 2533681..2534622 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
| JL017_RS12240 | 2534623..2535636 | - | 1014 | WP_000220399.1 | ABC transporter ATP-binding protein | - |
| JL017_RS12245 | 2535654..2536799 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| JL017_RS12250 | 2537044..2538450 | - | 1407 | WP_000760586.1 | PLP-dependent aminotransferase family protein | - |
| JL017_RS12255 | 2538529..2538945 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| JL017_RS12260 | 2538991..2539167 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| JL017_RS12265 | 2539389..2539619 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| JL017_RS12270 | 2539711..2541672 | - | 1962 | WP_001355676.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| JL017_RS12275 | 2541745..2542281 | - | 537 | WP_000429133.1 | DNA-binding transcriptional regulator SutR | - |
| JL017_RS12280 | 2542334..2543548 | + | 1215 | WP_071597387.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2543588..2544736 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T290156 WP_000813794.1 NZ_LR883050:c2539167-2538991 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT290156 WP_001270286.1 NZ_LR883050:c2538945-2538529 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|