Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1059948..1060531 | Replicon | chromosome |
Accession | NZ_LR883012 | ||
Organism | Escherichia coli isolate L4_E1441_ETEC |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | JLZ95_RS05020 | Protein ID | WP_000254738.1 |
Coordinates | 1060196..1060531 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | JLZ95_RS05015 | Protein ID | WP_000581937.1 |
Coordinates | 1059948..1060196 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JLZ95_RS05005 | 1056287..1057588 | + | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
JLZ95_RS05010 | 1057636..1059870 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
JLZ95_RS05015 | 1059948..1060196 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
JLZ95_RS05020 | 1060196..1060531 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
JLZ95_RS05025 | 1060602..1061393 | + | 792 | WP_005761044.1 | nucleoside triphosphate pyrophosphohydrolase | - |
JLZ95_RS05030 | 1061621..1063258 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
JLZ95_RS05035 | 1063346..1064644 | + | 1299 | WP_000036729.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T290125 WP_000254738.1 NZ_LR883012:1060196-1060531 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|