Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 938283..938937 | Replicon | chromosome |
| Accession | NZ_LR883012 | ||
| Organism | Escherichia coli isolate L4_E1441_ETEC | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | JLZ95_RS04520 | Protein ID | WP_000244781.1 |
| Coordinates | 938530..938937 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | JLZ95_RS04515 | Protein ID | WP_000354046.1 |
| Coordinates | 938283..938549 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JLZ95_RS04495 | 934371..935804 | - | 1434 | WP_001394742.1 | 6-phospho-beta-glucosidase BglA | - |
| JLZ95_RS04500 | 935849..936160 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
| JLZ95_RS04505 | 936324..936983 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| JLZ95_RS04510 | 937060..938040 | - | 981 | WP_000886087.1 | tRNA-modifying protein YgfZ | - |
| JLZ95_RS04515 | 938283..938549 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| JLZ95_RS04520 | 938530..938937 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| JLZ95_RS04525 | 938977..939498 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| JLZ95_RS04530 | 939610..940506 | + | 897 | WP_001735667.1 | site-specific tyrosine recombinase XerD | - |
| JLZ95_RS04535 | 940531..941241 | + | 711 | WP_000715222.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| JLZ95_RS04540 | 941247..942980 | + | 1734 | WP_000813233.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T290124 WP_000244781.1 NZ_LR883012:938530-938937 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|