Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 843918..844750 | Replicon | chromosome |
| Accession | NZ_LR883012 | ||
| Organism | Escherichia coli isolate L4_E1441_ETEC | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A7ZVJ9 |
| Locus tag | JLZ95_RS04025 | Protein ID | WP_000854765.1 |
| Coordinates | 843918..844292 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | JLZ95_RS04030 | Protein ID | WP_001295723.1 |
| Coordinates | 844382..844750 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JLZ95_RS04005 | 841710..842930 | + | 1221 | WP_001735713.1 | capsular biosynthesis protein | - |
| JLZ95_RS04010 | 842953..843189 | - | 237 | WP_001735712.1 | hypothetical protein | - |
| JLZ95_RS04015 | 843292..843468 | - | 177 | WP_000839288.1 | DUF957 domain-containing protein | - |
| JLZ95_RS04020 | 843485..843921 | - | 437 | Protein_790 | hypothetical protein | - |
| JLZ95_RS04025 | 843918..844292 | - | 375 | WP_000854765.1 | TA system toxin CbtA family protein | Toxin |
| JLZ95_RS04030 | 844382..844750 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| JLZ95_RS04035 | 844913..845134 | - | 222 | WP_001735710.1 | DUF987 domain-containing protein | - |
| JLZ95_RS04040 | 845203..845679 | - | 477 | WP_001186725.1 | RadC family protein | - |
| JLZ95_RS04045 | 845695..846180 | - | 486 | WP_001735709.1 | antirestriction protein | - |
| JLZ95_RS04050 | 846235..847053 | - | 819 | WP_074481115.1 | DUF945 domain-containing protein | - |
| JLZ95_RS04055 | 847208..847366 | - | 159 | WP_001323397.1 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13970.98 Da Isoelectric Point: 7.2909
>T290123 WP_000854765.1 NZ_LR883012:c844292-843918 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT290123 WP_001295723.1 NZ_LR883012:c844750-844382 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|