290120

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 7086..7579 Replicon plasmid 6
Accession NZ_LR883011
Organism Escherichia coli isolate L5_E1779_ETEC

Toxin (Protein)


Gene name TsxA Uniprot ID U9Y9W8
Locus tag JL014_RS26435 Protein ID WP_001230709.1
Coordinates 7086..7340 (+) Length 85 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID U9Y4R8
Locus tag JL014_RS26440 Protein ID WP_000151456.1
Coordinates 7337..7579 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JL014_RS26400 2132..2434 - 303 WP_001096511.1 hypothetical protein -
JL014_RS26405 2524..3183 - 660 WP_000516232.1 peptidyl-arginine deiminase -
JL014_RS26410 3736..4059 + 324 WP_001733848.1 hypothetical protein -
JL014_RS26415 4413..4757 + 345 WP_001146936.1 type II toxin-antitoxin system RelE/ParE family toxin -
JL014_RS26420 4744..5094 + 351 WP_000127482.1 addiction module antitoxin -
JL014_RS26425 5928..6443 + 516 WP_001025393.1 J domain-containing protein -
JL014_RS26430 6547..7089 + 543 WP_001083904.1 hypothetical protein -
JL014_RS26435 7086..7340 + 255 WP_001230709.1 hypothetical protein Toxin
JL014_RS26440 7337..7579 + 243 WP_000151456.1 hypothetical protein Antitoxin
JL014_RS26445 8150..8443 + 294 WP_000673431.1 hypothetical protein -
JL014_RS26450 8748..9035 + 288 WP_000606467.1 hypothetical protein -
JL014_RS26455 9463..9696 + 234 WP_000093745.1 hypothetical protein -
JL014_RS26460 9772..10074 + 303 WP_000379301.1 hypothetical protein -
JL014_RS26465 10310..10495 + 186 Protein_15 hypothetical protein -
JL014_RS26470 10606..11427 + 822 WP_001234372.1 DUF945 domain-containing protein -
JL014_RS26475 11724..12326 - 603 WP_072205450.1 transglycosylase SLT domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..61528 61528


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9942.47 Da        Isoelectric Point: 10.1206

>T290120 WP_001230709.1 NZ_LR883011:7086-7340 [Escherichia coli]
MRKNKGRLTYYLEVIDKKYHFVKKISSYSKEFTDGKTKRTKRTLSELVFNESEVEAIDFTKNGLRPVDKNILLTMVKEYK
ESDA

Download         Length: 255 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9136.45 Da        Isoelectric Point: 7.2775

>AT290120 WP_000151456.1 NZ_LR883011:7337-7579 [Escherichia coli]
MTIENTPENIKKLRKKIGLTQTECGEIFGVGLSTWQKKEAKTHNQLNLSKGEFEYLLLLAGEHPEYVLHKKAESRSPEEP

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3G9H8F0

Antitoxin

Source ID Structure
AlphaFold DB A0A3G9GNF5

References