Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 48433..48958 Replicon plasmid 3
Accession NZ_LR883008
Organism Escherichia coli isolate L5_E1779_ETEC

Toxin (Protein)


Gene name ccdB Uniprot ID T2HS38
Locus tag JL014_RS24815 Protein ID WP_001159861.1
Coordinates 48653..48958 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID T2HUI2
Locus tag JL014_RS24810 Protein ID WP_000813631.1
Coordinates 48433..48651 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JL014_RS24785 44109..45227 - 1119 Protein_57 IS3 family transposase -
JL014_RS24790 45403..45819 - 417 WP_001044769.1 type II toxin-antitoxin system VapC family toxin -
JL014_RS24795 45816..46046 - 231 WP_001261281.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
JL014_RS24800 46538..47155 + 618 WP_001398801.1 RES family NAD+ phosphorylase -
JL014_RS24805 47189..47878 - 690 WP_001095858.1 helix-turn-helix domain-containing protein -
JL014_RS24810 48433..48651 + 219 WP_000813631.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
JL014_RS24815 48653..48958 + 306 WP_001159861.1 type II toxin-antitoxin system toxin CcdB Toxin
JL014_RS24820 48959..49765 + 807 WP_000099345.1 site-specific integrase -
JL014_RS24825 50122..50502 + 381 WP_001466366.1 IS66 family insertion sequence hypothetical protein -
JL014_RS24830 50499..50846 + 348 WP_000612626.1 IS66 family insertion sequence element accessory protein TnpB -
JL014_RS24835 51068..51847 - 780 WP_001297096.1 IS21-like element IS100kyp family helper ATPase IstB -
JL014_RS24840 51847..52869 - 1023 WP_001356151.1 IS21 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - cssA / csfA 1..142377 142377
- inside IScluster/Tn - cssA 44200..74407 30207


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11680.49 Da        Isoelectric Point: 6.4674

>T290119 WP_001159861.1 NZ_LR883008:48653-48958 [Escherichia coli]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINMMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8372.39 Da        Isoelectric Point: 5.0807

>AT290119 WP_000813631.1 NZ_LR883008:48433-48651 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMKNEARRLRAERWKAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB T2HS38

Antitoxin

Source ID Structure
AlphaFold DB T2HUI2

References