Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 45403..46046 Replicon plasmid 3
Accession NZ_LR883008
Organism Escherichia coli isolate L5_E1779_ETEC

Toxin (Protein)


Gene name vagD Uniprot ID Q2VNX7
Locus tag JL014_RS24790 Protein ID WP_001044769.1
Coordinates 45403..45819 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID T2HRV4
Locus tag JL014_RS24795 Protein ID WP_001261281.1
Coordinates 45816..46046 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JL014_RS24765 40734..41360 + 627 WP_000593827.1 ABC transporter ATP-binding protein -
JL014_RS24770 41612..41839 + 228 WP_001731352.1 bacterial lipid A biosynthesis acyltransferase family protein -
JL014_RS24775 42233..42382 - 150 WP_001399277.1 ATP-binding protein -
JL014_RS24780 42401..43645 - 1245 WP_000115575.1 hypothetical protein -
JL014_RS24785 44109..45227 - 1119 Protein_57 IS3 family transposase -
JL014_RS24790 45403..45819 - 417 WP_001044769.1 type II toxin-antitoxin system VapC family toxin Toxin
JL014_RS24795 45816..46046 - 231 WP_001261281.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JL014_RS24800 46538..47155 + 618 WP_001398801.1 RES family NAD+ phosphorylase -
JL014_RS24805 47189..47878 - 690 WP_001095858.1 helix-turn-helix domain-containing protein -
JL014_RS24810 48433..48651 + 219 WP_000813631.1 type II toxin-antitoxin system antitoxin CcdA -
JL014_RS24815 48653..48958 + 306 WP_001159861.1 type II toxin-antitoxin system toxin CcdB -
JL014_RS24820 48959..49765 + 807 WP_000099345.1 site-specific integrase -
JL014_RS24825 50122..50502 + 381 WP_001466366.1 IS66 family insertion sequence hypothetical protein -
JL014_RS24830 50499..50846 + 348 WP_000612626.1 IS66 family insertion sequence element accessory protein TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - cssA / csfA 1..142377 142377
- inside IScluster/Tn - cssA 44200..74407 30207


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-44)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15183.63 Da        Isoelectric Point: 7.7805

>T290118 WP_001044769.1 NZ_LR883008:c45819-45403 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKVKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8769.89 Da        Isoelectric Point: 4.3775

>AT290118 WP_001261281.1 NZ_LR883008:c46046-45816 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPIRPTWGSFLECEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A7ZGW5

Antitoxin

Source ID Structure
AlphaFold DB T2HRV4

References