Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4271170..4271765 | Replicon | chromosome |
Accession | NZ_LR883006 | ||
Organism | Escherichia coli isolate L5_E1779_ETEC |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9Y4M4 |
Locus tag | JL014_RS20800 | Protein ID | WP_000239579.1 |
Coordinates | 4271415..4271765 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | U9Y2K1 |
Locus tag | JL014_RS20795 | Protein ID | WP_001223208.1 |
Coordinates | 4271170..4271421 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JL014_RS20785 | 4266835..4270614 | + | 3780 | WP_000060896.1 | autotransporter assembly complex protein TamB | - |
JL014_RS20790 | 4270617..4270958 | + | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
JL014_RS20795 | 4271170..4271421 | + | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
JL014_RS20800 | 4271415..4271765 | + | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
JL014_RS20805 | 4271845..4272375 | - | 531 | WP_000055075.1 | inorganic diphosphatase | - |
JL014_RS20810 | 4272685..4273641 | + | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
JL014_RS20815 | 4273951..4275453 | + | 1503 | WP_000205791.1 | sugar ABC transporter ATP-binding protein | - |
JL014_RS20820 | 4275467..4276489 | + | 1023 | WP_001355798.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T290114 WP_000239579.1 NZ_LR883006:4271415-4271765 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LQ26 |