Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3681434..3682271 | Replicon | chromosome |
Accession | NZ_LR883006 | ||
Organism | Escherichia coli isolate L5_E1779_ETEC |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | JL014_RS18025 | Protein ID | WP_000227784.1 |
Coordinates | 3681729..3682271 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | JL014_RS18020 | Protein ID | WP_001297137.1 |
Coordinates | 3681434..3681745 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JL014_RS17995 | 3676454..3677401 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
JL014_RS18000 | 3677423..3679414 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
JL014_RS18005 | 3679404..3680018 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
JL014_RS18010 | 3680018..3680347 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
JL014_RS18015 | 3680359..3681249 | + | 891 | WP_000971336.1 | heme o synthase | - |
JL014_RS18020 | 3681434..3681745 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
JL014_RS18025 | 3681729..3682271 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
JL014_RS18030 | 3682327..3683262 | - | 936 | WP_001297127.1 | sel1 repeat family protein | - |
JL014_RS18035 | 3683670..3685034 | + | 1365 | WP_001000978.1 | MFS transporter | - |
JL014_RS18040 | 3685162..3685653 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
JL014_RS18045 | 3685821..3686732 | + | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T290109 WP_000227784.1 NZ_LR883006:3681729-3682271 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|