Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3647357..3647975 | Replicon | chromosome |
Accession | NZ_LR883006 | ||
Organism | Escherichia coli isolate L5_E1779_ETEC |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | JL014_RS17855 | Protein ID | WP_001291435.1 |
Coordinates | 3647757..3647975 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | JL014_RS17850 | Protein ID | WP_000344800.1 |
Coordinates | 3647357..3647731 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JL014_RS17840 | 3642446..3643639 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
JL014_RS17845 | 3643662..3646811 | + | 3150 | WP_001132469.1 | multidrug efflux RND transporter permease subunit | - |
JL014_RS17850 | 3647357..3647731 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
JL014_RS17855 | 3647757..3647975 | + | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
JL014_RS17860 | 3648147..3648698 | + | 552 | WP_000102568.1 | maltose O-acetyltransferase | - |
JL014_RS17865 | 3648814..3649284 | + | 471 | WP_000136192.1 | YlaC family protein | - |
JL014_RS17870 | 3649448..3650998 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
JL014_RS17875 | 3651040..3651393 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
JL014_RS17885 | 3651772..3652083 | + | 312 | WP_000409911.1 | MGMT family protein | - |
JL014_RS17890 | 3652114..3652686 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T290108 WP_001291435.1 NZ_LR883006:3647757-3647975 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT290108 WP_000344800.1 NZ_LR883006:3647357-3647731 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |