Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1907292..1908124 Replicon chromosome
Accession NZ_LR883006
Organism Escherichia coli isolate L5_E1779_ETEC

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag JL014_RS09195 Protein ID WP_000854762.1
Coordinates 1907292..1907666 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1NM52
Locus tag JL014_RS09200 Protein ID WP_001295723.1
Coordinates 1907756..1908124 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JL014_RS09155 1902712..1902894 - 183 WP_001667686.1 ethanolamine utilization - propanediol utilization family protein -
JL014_RS09160 1903168..1903944 - 777 WP_001355942.1 IS21-like element IS100kyp family helper ATPase IstB -
JL014_RS09165 1903944..1904918 - 975 WP_001433436.1 IS21 family transposase -
JL014_RS09170 1905021..1905401 + 381 WP_001171554.1 IS66 family insertion sequence hypothetical protein -
JL014_RS09175 1905398..1905745 + 348 WP_000612588.1 IS66 family insertion sequence element accessory protein TnpB -
JL014_RS09180 1905795..1906856 + 1062 Protein_1796 IS66-like element ISEc8 family transposase -
JL014_RS09185 1906963..1907076 - 114 WP_001161660.1 DUF957 domain-containing protein -
JL014_RS09190 1907089..1907295 - 207 WP_000976829.1 hypothetical protein -
JL014_RS09195 1907292..1907666 - 375 WP_000854762.1 TA system toxin CbtA family protein Toxin
JL014_RS09200 1907756..1908124 - 369 WP_001295723.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
JL014_RS09205 1908222..1908656 + 435 WP_001403014.1 IS66 family insertion sequence hypothetical protein -
JL014_RS09210 1908653..1909003 + 351 WP_000624688.1 IS66 family insertion sequence element accessory protein TnpB -
JL014_RS09215 1909034..1910647 + 1614 WP_001744949.1 IS66-like element ISEc47 family transposase -
JL014_RS09220 1910836..1911057 - 222 WP_000692341.1 DUF987 domain-containing protein -
JL014_RS09225 1911120..1911596 - 477 WP_001186774.1 RadC family protein -
JL014_RS09230 1911612..1912085 - 474 WP_000855059.1 antirestriction protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 1899104..1910647 11543


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14094.15 Da        Isoelectric Point: 7.1881

>T290099 WP_000854762.1 NZ_LR883006:c1907666-1907292 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13592.40 Da        Isoelectric Point: 6.6255

>AT290099 WP_001295723.1 NZ_LR883006:c1908124-1907756 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB S1NM52

References