Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1391979..1392604 | Replicon | chromosome |
Accession | NZ_LR883006 | ||
Organism | Escherichia coli isolate L5_E1779_ETEC |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | JL014_RS06775 | Protein ID | WP_000911328.1 |
Coordinates | 1392206..1392604 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | JL014_RS06770 | Protein ID | WP_000450524.1 |
Coordinates | 1391979..1392206 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JL014_RS06745 | 1387782..1388252 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
JL014_RS06750 | 1388252..1388824 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
JL014_RS06755 | 1388970..1389848 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
JL014_RS06760 | 1389865..1390899 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
JL014_RS06765 | 1391112..1391825 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
JL014_RS06770 | 1391979..1392206 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
JL014_RS06775 | 1392206..1392604 | + | 399 | WP_000911328.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
JL014_RS06780 | 1392751..1393614 | + | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
JL014_RS06785 | 1393629..1395644 | + | 2016 | WP_000829355.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
JL014_RS06790 | 1395718..1396416 | + | 699 | WP_000679823.1 | esterase | - |
JL014_RS06795 | 1396526..1396726 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14966.32 Da Isoelectric Point: 8.5325
>T290097 WP_000911328.1 NZ_LR883006:1392206-1392604 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYEAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYEAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|