Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 904016..904670 | Replicon | chromosome |
| Accession | NZ_LR883006 | ||
| Organism | Escherichia coli isolate L5_E1779_ETEC | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | JL014_RS04385 | Protein ID | WP_000244781.1 |
| Coordinates | 904263..904670 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | JL014_RS04380 | Protein ID | WP_000354046.1 |
| Coordinates | 904016..904282 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JL014_RS04355 | 899185..899928 | + | 744 | WP_000951961.1 | SDR family oxidoreductase | - |
| JL014_RS04360 | 899985..901418 | - | 1434 | WP_001344773.1 | 6-phospho-beta-glucosidase BglA | - |
| JL014_RS04365 | 901463..901774 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
| JL014_RS04370 | 901938..902597 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| JL014_RS04375 | 902793..903773 | - | 981 | WP_000886095.1 | tRNA-modifying protein YgfZ | - |
| JL014_RS04380 | 904016..904282 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| JL014_RS04385 | 904263..904670 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| JL014_RS04390 | 904710..905231 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| JL014_RS04395 | 905343..906239 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| JL014_RS04400 | 906264..906974 | + | 711 | WP_000715208.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| JL014_RS04405 | 906980..908713 | + | 1734 | WP_000813218.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T290095 WP_000244781.1 NZ_LR883006:904263-904670 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|