Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 264412..264971 Replicon plasmid 2
Accession NZ_LR882998
Organism Escherichia coli isolate L3_E36_ETEC

Toxin (Protein)


Gene name relE Uniprot ID S1PMX5
Locus tag JL022_RS26630 Protein ID WP_000421257.1
Coordinates 264412..264687 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID U9Y625
Locus tag JL022_RS26635 Protein ID WP_001178087.1
Coordinates 264687..264971 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JL022_RS26605 261525..262264 - 740 Protein_315 IS3 family transposase -
JL022_RS26610 262386..262616 - 231 Protein_316 transposase -
JL022_RS26615 262611..262700 - 90 Protein_317 invasion protein -
JL022_RS26620 262694..262966 + 273 WP_001695087.1 hypothetical protein -
JL022_RS26625 262947..264155 + 1209 WP_001695118.1 IS91 family transposase -
JL022_RS26630 264412..264687 - 276 WP_000421257.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
JL022_RS26635 264687..264971 - 285 WP_001178087.1 ribbon-helix-helix domain-containing protein Antitoxin
JL022_RS26640 265874..266731 - 858 WP_000130956.1 incFII family plasmid replication initiator RepA -
JL022_RS26645 266724..266798 - 75 WP_001365705.1 RepA leader peptide Tap -
JL022_RS26650 267024..267284 - 261 WP_000083816.1 replication regulatory protein RepA -
JL022_RS26655 267568..267699 - 132 WP_064765989.1 type I toxin-antitoxin system Hok family toxin -
JL022_RS26660 267737..268476 + 740 Protein_326 IS3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - eltB / eltA / cofA / etpA / etpB / cfaA / cfaB / cfaC / cfaE / cfaD' 1..381858 381858
- inside IScluster/Tn - - 258306..281095 22789


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 9.9324

>T290086 WP_000421257.1 NZ_LR882998:c264687-264412 [Escherichia coli]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10488.92 Da        Isoelectric Point: 5.6558

>AT290086 WP_001178087.1 NZ_LR882998:c264971-264687 [Escherichia coli]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWIIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PMX5

Antitoxin

Source ID Structure
AlphaFold DB U9Y625

References