Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 132271..132806 Replicon plasmid 2
Accession NZ_LR882998
Organism Escherichia coli isolate L3_E36_ETEC

Toxin (Protein)


Gene name relE Uniprot ID A0A0M1UJC2
Locus tag JL022_RS25865 Protein ID WP_001270422.1
Coordinates 132271..132558 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID L4J0V6
Locus tag JL022_RS25870 Protein ID WP_001132895.1
Coordinates 132555..132806 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JL022_RS25835 127353..127511 + 159 WP_200995772.1 hypothetical protein -
JL022_RS25840 127737..128042 - 306 WP_000336590.1 major pilus subunit operon regulatory protein PapB -
JL022_RS25845 129005..129133 + 129 WP_032164396.1 hypothetical protein -
JL022_RS25850 129254..129994 + 741 WP_001066944.1 tyrosine-type recombinase/integrase -
JL022_RS25855 130237..131214 - 978 WP_000361613.1 RepB family plasmid replication initiator protein -
JL022_RS25860 131858..132269 - 412 Protein_166 DDE-type integrase/transposase/recombinase -
JL022_RS25865 132271..132558 - 288 WP_001270422.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
JL022_RS25870 132555..132806 - 252 WP_001132895.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JL022_RS25875 133564..134769 + 1206 WP_000817635.1 AAA family ATPase -
JL022_RS25880 134766..135728 + 963 WP_000756328.1 ParB/RepB/Spo0J family partition protein -
JL022_RS25885 135962..136738 + 777 Protein_171 hypothetical protein -
JL022_RS25890 136905..137048 + 144 WP_000270807.1 DUF1281 domain-containing protein -
JL022_RS25895 137055..137414 + 360 WP_001336695.1 DUF1281 domain-containing protein -
JL022_RS25900 137478..137720 + 243 WP_113365707.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - eltB / eltA / cofA / etpA / etpB / cfaA / cfaB / cfaC / cfaE / cfaD' 1..381858 381858


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11262.30 Da        Isoelectric Point: 10.4703

>T290082 WP_001270422.1 NZ_LR882998:c132558-132271 [Escherichia coli]
MRYQVKFREDALKEWQKMDKTIQQQFAKKLKKCCDNPHIPSAKLRGIKDCYKIKLRASGFRLVYQVIDEQLIIAVVAVGK
RERSDVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9178.47 Da        Isoelectric Point: 4.2108

>AT290082 WP_001132895.1 NZ_LR882998:c132806-132555 [Escherichia coli]
MPNIILSDTSASVSELKKNPMATVSAGDGFPVAILNRNQPAFYCVPAELYEKMLDALDDQELVKLVAERSNQPLHDVDLD
KYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0M1UJC2

Antitoxin

Source ID Structure
AlphaFold DB L4J0V6

References