Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3918585..3919422 | Replicon | chromosome |
Accession | NZ_LR882997 | ||
Organism | Escherichia coli isolate L3_E36_ETEC |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | JL022_RS19295 | Protein ID | WP_000227784.1 |
Coordinates | 3918880..3919422 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | JL022_RS19290 | Protein ID | WP_001297137.1 |
Coordinates | 3918585..3918896 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JL022_RS19265 | 3913605..3914552 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
JL022_RS19270 | 3914574..3916565 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
JL022_RS19275 | 3916555..3917169 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
JL022_RS19280 | 3917169..3917498 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
JL022_RS19285 | 3917510..3918400 | + | 891 | WP_000971336.1 | heme o synthase | - |
JL022_RS19290 | 3918585..3918896 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
JL022_RS19295 | 3918880..3919422 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
JL022_RS19300 | 3919478..3920413 | - | 936 | WP_001387350.1 | sel1 repeat family protein | - |
JL022_RS19305 | 3920821..3922185 | + | 1365 | WP_001000965.1 | MFS transporter | - |
JL022_RS19310 | 3922313..3922804 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
JL022_RS19315 | 3922972..3923883 | + | 912 | WP_000705865.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T290073 WP_000227784.1 NZ_LR882997:3918880-3919422 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|