Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3165547..3166391 | Replicon | chromosome |
| Accession | NZ_LR882997 | ||
| Organism | Escherichia coli isolate L3_E36_ETEC | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | B1LJY4 |
| Locus tag | JL022_RS15790 | Protein ID | WP_000854686.1 |
| Coordinates | 3165547..3165930 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A8E0J1S3 |
| Locus tag | JL022_RS15795 | Protein ID | WP_001285602.1 |
| Coordinates | 3166011..3166391 (-) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JL022_RS15750 | 3160549..3161040 | - | 492 | WP_001297187.1 | DUF1097 domain-containing protein | - |
| JL022_RS15755 | 3161142..3161696 | - | 555 | WP_001001902.1 | molecular chaperone YcdY | - |
| JL022_RS15760 | 3161720..3162457 | - | 738 | WP_000283664.1 | zinc-binding phosphatase | - |
| JL022_RS15765 | 3162512..3163450 | - | 939 | WP_000351317.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| JL022_RS15775 | 3163921..3164763 | - | 843 | WP_001696893.1 | DUF4942 domain-containing protein | - |
| JL022_RS15780 | 3164848..3165045 | - | 198 | WP_000839253.1 | DUF957 domain-containing protein | - |
| JL022_RS15785 | 3165062..3165550 | - | 489 | WP_001696892.1 | hypothetical protein | - |
| JL022_RS15790 | 3165547..3165930 | - | 384 | WP_000854686.1 | TA system toxin CbtA family protein | Toxin |
| JL022_RS15795 | 3166011..3166391 | - | 381 | WP_001285602.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| JL022_RS15800 | 3166402..3167085 | - | 684 | WP_001696891.1 | hypothetical protein | - |
| JL022_RS15805 | 3167104..3167325 | - | 222 | WP_001696890.1 | DUF987 domain-containing protein | - |
| JL022_RS15810 | 3167388..3167864 | - | 477 | WP_001186726.1 | RadC family protein | - |
| JL022_RS15815 | 3167880..3168365 | - | 486 | WP_001697217.1 | antirestriction protein | - |
| JL022_RS15820 | 3168457..3169275 | - | 819 | WP_001697216.1 | DUF945 domain-containing protein | - |
| JL022_RS15825 | 3169375..3169608 | - | 234 | WP_001119719.1 | DUF905 family protein | - |
| JL022_RS15830 | 3169687..3170141 | - | 455 | Protein_3104 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14272.28 Da Isoelectric Point: 6.8614
>T290071 WP_000854686.1 NZ_LR882997:c3165930-3165547 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ
Download Length: 384 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13938.69 Da Isoelectric Point: 5.0823
>AT290071 WP_001285602.1 NZ_LR882997:c3166391-3166011 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|