Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1996474..1997306 | Replicon | chromosome |
| Accession | NZ_LR882997 | ||
| Organism | Escherichia coli isolate L3_E36_ETEC | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | JL022_RS09685 | Protein ID | WP_000854762.1 |
| Coordinates | 1996474..1996848 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | JL022_RS09690 | Protein ID | WP_001295723.1 |
| Coordinates | 1996938..1997306 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JL022_RS09660 | 1991690..1993198 | - | 1509 | WP_001189123.1 | group II intron reverse transcriptase/maturase | - |
| JL022_RS09665 | 1993871..1994610 | - | 740 | Protein_1893 | IS3 family transposase | - |
| JL022_RS09670 | 1994660..1996024 | + | 1365 | Protein_1894 | IS66-like element ISEc23 family transposase | - |
| JL022_RS09675 | 1996145..1996258 | - | 114 | WP_001161660.1 | DUF957 domain-containing protein | - |
| JL022_RS09680 | 1996271..1996477 | - | 207 | WP_000976829.1 | hypothetical protein | - |
| JL022_RS09685 | 1996474..1996848 | - | 375 | WP_000854762.1 | TA system toxin CbtA family protein | Toxin |
| JL022_RS09690 | 1996938..1997306 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| JL022_RS09695 | 1997469..1997690 | - | 222 | WP_000692341.1 | DUF987 domain-containing protein | - |
| JL022_RS09700 | 1997753..1998229 | - | 477 | WP_001186774.1 | RadC family protein | - |
| JL022_RS09705 | 1998245..1998718 | - | 474 | WP_000855059.1 | antirestriction protein | - |
| JL022_RS09710 | 1999060..1999878 | - | 819 | WP_001234652.1 | DUF945 domain-containing protein | - |
| JL022_RS09715 | 2000033..2000191 | - | 159 | WP_001433433.1 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1985710..2003108 | 17398 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14094.15 Da Isoelectric Point: 7.1881
>T290065 WP_000854762.1 NZ_LR882997:c1996848-1996474 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT290065 WP_001295723.1 NZ_LR882997:c1997306-1996938 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|