Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1476138..1476763 | Replicon | chromosome |
| Accession | NZ_LR882997 | ||
| Organism | Escherichia coli isolate L3_E36_ETEC | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | U9YZ02 |
| Locus tag | JL022_RS07285 | Protein ID | WP_000911329.1 |
| Coordinates | 1476365..1476763 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | JL022_RS07280 | Protein ID | WP_001696518.1 |
| Coordinates | 1476138..1476365 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JL022_RS07255 | 1471940..1472410 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| JL022_RS07260 | 1472410..1472982 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| JL022_RS07265 | 1473128..1474006 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| JL022_RS07270 | 1474023..1475057 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| JL022_RS07275 | 1475270..1475983 | + | 714 | WP_200995751.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| JL022_RS07280 | 1476138..1476365 | + | 228 | WP_001696518.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| JL022_RS07285 | 1476365..1476763 | + | 399 | WP_000911329.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| JL022_RS07290 | 1476910..1477773 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
| JL022_RS07295 | 1477788..1479803 | + | 2016 | WP_001388162.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| JL022_RS07300 | 1479877..1480575 | + | 699 | WP_000679812.1 | esterase | - |
| JL022_RS07305 | 1480656..1480856 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | algU | 1333982..1504928 | 170946 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T290063 WP_000911329.1 NZ_LR882997:1476365-1476763 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|