Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 124198..124772 | Replicon | plasmid 2 |
Accession | NZ_LR882991 | ||
Organism | Escherichia coli isolate L7_E1373_ETEC |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0S3PMZ8 |
Locus tag | JLZ97_RS24230 | Protein ID | WP_001595119.1 |
Coordinates | 124198..124524 (-) | Length | 109 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0S3PN98 |
Locus tag | JLZ97_RS24235 | Protein ID | WP_001595120.1 |
Coordinates | 124521..124772 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JLZ97_RS24210 | 119421..121856 | + | 2436 | WP_157757767.1 | CS6 fimbrial usher CssD | - |
JLZ97_RS24215 | 121870..122432 | - | 563 | Protein_148 | IS1 family transposase | - |
JLZ97_RS24220 | 122621..123798 | - | 1178 | Protein_149 | IS91 family transposase | - |
JLZ97_RS24225 | 123798..124094 | - | 297 | WP_000766063.1 | hypothetical protein | - |
JLZ97_RS24230 | 124198..124524 | - | 327 | WP_001595119.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JLZ97_RS24235 | 124521..124772 | - | 252 | WP_001595120.1 | hypothetical protein | Antitoxin |
JLZ97_RS24240 | 125326..126192 | + | 867 | WP_001595122.1 | AAA family ATPase | - |
JLZ97_RS24245 | 126192..127223 | + | 1032 | WP_001595123.1 | ParB/RepB/Spo0J family partition protein | - |
JLZ97_RS24250 | 127247..127660 | + | 414 | WP_032159708.1 | hypothetical protein | - |
JLZ97_RS24255 | 127657..127980 | + | 324 | WP_000143877.1 | hypothetical protein | - |
JLZ97_RS24260 | 128019..129293 | - | 1275 | WP_001595125.1 | Y-family DNA polymerase | - |
JLZ97_RS24265 | 129293..129715 | - | 423 | WP_001595126.1 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | cofA / faeD / faeE / estIa / cssA | 1..146433 | 146433 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 12187.44 Da Isoelectric Point: 10.4373
>T290058 WP_001595119.1 NZ_LR882991:c124524-124198 [Escherichia coli]
MTYTVKFRDDALKEWLKLDKAIQQQFAKKLKKCSENPHIPSAKLRGIKDCYKIKLRASGFRLVYQVIDDQLIIAVVAIGK
RERSDVYNLASRVGSLAAAACHGLKLPL
MTYTVKFRDDALKEWLKLDKAIQQQFAKKLKKCSENPHIPSAKLRGIKDCYKIKLRASGFRLVYQVIDDQLIIAVVAIGK
RERSDVYNLASRVGSLAAAACHGLKLPL
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3PMZ8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3PN98 |