Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2510117..2510755 | Replicon | chromosome |
| Accession | NZ_LR882990 | ||
| Organism | Escherichia coli isolate L7_E1373_ETEC | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A3T4J978 |
| Locus tag | JLZ97_RS11920 | Protein ID | WP_001612987.1 |
| Coordinates | 2510579..2510755 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | JLZ97_RS11915 | Protein ID | WP_001270286.1 |
| Coordinates | 2510117..2510533 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JLZ97_RS11895 | 2505269..2506210 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
| JLZ97_RS11900 | 2506211..2507224 | - | 1014 | WP_000220411.1 | ABC transporter ATP-binding protein | - |
| JLZ97_RS11905 | 2507242..2508387 | - | 1146 | WP_001612991.1 | ABC transporter substrate-binding protein | - |
| JLZ97_RS11910 | 2508632..2510038 | - | 1407 | WP_001718258.1 | PLP-dependent aminotransferase family protein | - |
| JLZ97_RS11915 | 2510117..2510533 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| JLZ97_RS11920 | 2510579..2510755 | - | 177 | WP_001612987.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| JLZ97_RS11925 | 2510977..2511207 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| JLZ97_RS11930 | 2511299..2513260 | - | 1962 | WP_001718255.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| JLZ97_RS11935 | 2513333..2513869 | - | 537 | WP_000429147.1 | DNA-binding transcriptional regulator SutR | - |
| JLZ97_RS11940 | 2513922..2515136 | + | 1215 | WP_072148478.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2515176..2516324 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6725.78 Da Isoelectric Point: 10.9223
>T290054 WP_001612987.1 NZ_LR882990:c2510755-2510579 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKVRFHGMRSVMPRHPCDEIKEPLRKAIQKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKVRFHGMRSVMPRHPCDEIKEPLRKAIQKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT290054 WP_001270286.1 NZ_LR882990:c2510533-2510117 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|