Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 354597..355397 | Replicon | chromosome |
| Accession | NZ_LR882990 | ||
| Organism | Escherichia coli isolate L7_E1373_ETEC | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | A0A0K4AFE4 |
| Locus tag | JLZ97_RS01560 | Protein ID | WP_001614005.1 |
| Coordinates | 354870..355397 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | F4NNI1 |
| Locus tag | JLZ97_RS01555 | Protein ID | WP_001277108.1 |
| Coordinates | 354597..354863 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JLZ97_RS01535 | 350255..350923 | + | 669 | WP_001718990.1 | cell division ATP-binding protein FtsE | - |
| JLZ97_RS01540 | 350916..351974 | + | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
| JLZ97_RS01545 | 352219..353073 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| JLZ97_RS01550 | 353344..354447 | + | 1104 | WP_001021996.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| JLZ97_RS01555 | 354597..354863 | + | 267 | WP_001277108.1 | DUF1778 domain-containing protein | Antitoxin |
| JLZ97_RS01560 | 354870..355397 | + | 528 | WP_001614005.1 | GNAT family N-acetyltransferase | Toxin |
| JLZ97_RS01565 | 355394..355777 | - | 384 | WP_001614003.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| JLZ97_RS01570 | 356201..357310 | + | 1110 | WP_001301528.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| JLZ97_RS01575 | 357358..358284 | + | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| JLZ97_RS01580 | 358281..359558 | + | 1278 | WP_001614002.1 | branched chain amino acid ABC transporter permease LivM | - |
| JLZ97_RS01585 | 359555..360322 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19676.62 Da Isoelectric Point: 7.3502
>T290047 WP_001614005.1 NZ_LR882990:354870-355397 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0K4AFE4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6GTS | |
| PDB | 6AJN | |
| PDB | 6GTQ | |
| PDB | 6GTO | |
| PDB | 6GTR | |
| PDB | 6AJM | |
| AlphaFold DB | A0A829CN24 |