Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 68681..69513 Replicon chromosome
Accession NZ_LR882990
Organism Escherichia coli isolate L7_E1373_ETEC

Toxin (Protein)


Gene name yeeV Uniprot ID E3PN67
Locus tag JLZ97_RS00280 Protein ID WP_000854775.1
Coordinates 68681..69055 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A426P7N5
Locus tag JLZ97_RS00285 Protein ID WP_001285645.1
Coordinates 69145..69513 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JLZ97_RS00250 64040..64963 - 924 WP_000535959.1 carboxylate/amino acid/amine transporter -
JLZ97_RS00255 65074..66258 - 1185 WP_001719114.1 sugar efflux transporter -
JLZ97_RS00260 66655..66819 - 165 Protein_51 virulence RhuM family protein -
JLZ97_RS00265 67057..67899 - 843 WP_001274548.1 DUF4942 domain-containing protein -
JLZ97_RS00270 67984..68181 - 198 WP_000772035.1 DUF957 domain-containing protein -
JLZ97_RS00275 68193..68684 - 492 WP_000976825.1 hypothetical protein -
JLZ97_RS00280 68681..69055 - 375 WP_000854775.1 TA system toxin CbtA family protein Toxin
JLZ97_RS00285 69145..69513 - 369 WP_001285645.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
JLZ97_RS00290 69676..69897 - 222 WP_000692303.1 DUF987 domain-containing protein -
JLZ97_RS00295 69966..70442 - 477 WP_001186201.1 RadC family protein -
JLZ97_RS00300 70458..70943 - 486 WP_000213721.1 antirestriction protein -
JLZ97_RS00305 71035..71853 - 819 WP_001175173.1 DUF945 domain-containing protein -
JLZ97_RS00310 71943..72176 - 234 WP_001278284.1 DUF905 family protein -
JLZ97_RS00315 72182..72859 - 678 WP_001097567.1 hypothetical protein -
JLZ97_RS00320 73010..73690 - 681 WP_001282911.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13965.02 Da        Isoelectric Point: 8.2830

>T290045 WP_000854775.1 NZ_LR882990:c69055-68681 [Escherichia coli]
MKTLPDTLVREASRCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13678.37 Da        Isoelectric Point: 5.4492

>AT290045 WP_001285645.1 NZ_LR882990:c69513-69145 [Escherichia coli]
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRADIRGRFSDADAYHLDQAFPLLMKQLELMLTNG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB E3PN67

Antitoxin

Source ID Structure
AlphaFold DB A0A426P7N5

References